PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ciclev10021174m
Common NameCICLE_v10021174mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family WRKY
Protein Properties Length: 323aa    MW: 35562.8 Da    PI: 8.6026
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ciclev10021174mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY1092.3e-34169226259
                      --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
             WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                      +Dgy+WrKYGqK vk+s+fprsYYrCtsa+C+vkk+vers +dp++v++tYeg+Hnh+
  Ciclev10021174m 169 EDGYRWRKYGQKAVKDSPFPRSYYRCTSASCNVKKRVERSYTDPSIVVTTYEGQHNHP 226
                      8********************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0381301.0E-1111322IPR017396PWRKY transcription factor, group IIc
Gene3DG3DSA:2.20.25.807.1E-35153228IPR003657WRKY domain
SuperFamilySSF1182902.09E-29160228IPR003657WRKY domain
PROSITE profilePS5081132.753163228IPR003657WRKY domain
SMARTSM007741.9E-39168227IPR003657WRKY domain
PfamPF031061.7E-26169226IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009624Biological Processresponse to nematode
GO:0009733Biological Processresponse to auxin
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 323 aa     Download sequence    Send to blast
MERKEVTKTK NHNNMGSSPF ADHLSTGSQL RGVFDLYEGE KGSLGFMELL GVQDFGSSSP  60
PSSSLFDMVQ FQAQNQVPSK GASASSTVNV TKIECSELLN QPATPNSSSI SSASSEALND  120
EQVKVEEHVH DEQNQQKTKK QLKPKKTNQK RQREPRFAFM TKSEVDHLED GYRWRKYGQK  180
AVKDSPFPRS YYRCTSASCN VKKRVERSYT DPSIVVTTYE GQHNHPSPLL PRPTLGGVPH  240
AGNGVVGSSF GMPMPAAFSQ QQLPSLVNSL LPMNFGSSFI NGPTTASFLH ERRFCTPAAG  300
TDLLKDHGLL QDIVPSHMLR EE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2lex_A5e-29158228777Probable WRKY transcription factor 4
1wj2_A5e-29158228777Probable WRKY transcription factor 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00069PBMTransfer from AT2G47260Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006444538.10.0hypothetical protein CICLE_v10021174mg
SwissprotO229003e-73WRK23_ARATH; Probable WRKY transcription factor 23
TrEMBLV4TBU90.0V4TBU9_9R
STRINGPOPTR_0002s19390.13e-95(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM61522647
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47260.12e-62WRKY DNA-binding protein 23